DPCfam | MC237717
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 270 ± 47 aa |
| Residues in low-complexity regions (%) | 2.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.05 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00274 |
| Sequences matching dominant architecture (%) | 85.25 |
| Average overlap percent | 89.09 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151NE83 | 364-683 | 320 | AHKIVASGKGILAADESVGTMGNRLQRINVENTEENRRAFREILFSSDASINQSIGGVIFFHETLYQKDSSGKLFPDVIKNKGIV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P05065-F1 | 27-328 | 99.67 | 98.27 | View in AlphaFoldDB ↗ |