DPCfam | MC23771
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 145 ± 4 aa |
| Residues in low-complexity regions (%) | 1.77 |
| Residues in coiled-coil regions (%) | 0.16 |
| Predicted disordered residues (%) | 21.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02011 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 29.29 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| P50899 | 325-468 | 144 | YTLFDKYFKKIGCTSPTCAAGQGREAAHYLLSWYMAWGGATDTSSGWAWRIGSSHAHFGYQNPLAAWALSTDPKLTPKSPTAKAD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P22534-F1 | 1375-1515 | 99.31 | 98.05 | View in AlphaFoldDB ↗ |