DPCfam | MC237707
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 176 ± 23 aa |
| Residues in low-complexity regions (%) | 1.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q6RPR8 | 312-475 | 164 | EAYQPVIAKYVTALTEHWGGEACSNADISILVSYVTSPSELGYALLDLDNDGTDELIIANDAERQVIYDLYSLVDGKLVHVFTGW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5K4FCH1-F1 | 104-152 | 25.52 | 94.64 | View in AlphaFoldDB ↗ |