DPCfam | MC237579
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 138 ± 16 aa |
| Residues in low-complexity regions (%) | 11.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 50.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12448 |
| Sequences matching dominant architecture (%) | 95.95 |
| Average overlap percent | 54.04 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D5P961 | 386-557 | 172 | VGPRAAPGRQDLEAAVQRLSVQQQCHSEEERSFFEAEREHKLWRLRDEDGSSGIPTPNGSVVSAGTTCSGGSEHTAASGFSLGSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4ACC5-F1 | 481-629 | 100.00 | 59.63 | View in AlphaFoldDB ↗ |