DPCfam | MC237567
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Residues in low-complexity regions (%) | 1.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04680 |
| Sequences matching dominant architecture (%) | 0.47 |
| Average overlap percent | 5.61 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004F49071 | 6-94 | 89 | HEFYFEGDNWDYVLQKRRGNVEEALAAETARALQCERGDVSDVVLDAKADTLVAFVTVRHLDTLGEDQIGDALAAHAYKELWDLY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DE24-F1 | 710-801 | 97.87 | 78.46 | View in AlphaFoldDB ↗ |