DPCfam | MC237499
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 76 ± 10 aa |
| Residues in low-complexity regions (%) | 0.95 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.18 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A094HJB5 | 10-68 | 59 | SSDSQLKLTILPTDVKLITKPEDLYQWSILTAGKAALFNKQLSKHLTRAYIDLRNGAGY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2EZU5-F1 | 11-92 | 98.75 | 89.59 | View in AlphaFoldDB ↗ |