DPCfam | MC23746
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Residues in low-complexity regions (%) | 7.0 |
| Residues in coiled-coil regions (%) | 0.51 |
| Predicted disordered residues (%) | 0.44 |
| Average transmembrane regions | 1.92 |
| Dominant Pfam architecture(s) | PF05640 |
| Sequences matching dominant architecture (%) | 92.38 |
| Average overlap percent | 56.01 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K8UDJ5 | 5-100 | 96 | TRRHFMLSTCLLQMITIIERQVFDFLGYMWAPILVNFFHIIFIILGFYGAYHFRIKYIITYLIWSFVWIGWNAFLICFYLNVGIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9JMG4-F1 | 10-98 | 97.80 | 85.41 | View in AlphaFoldDB ↗ |