DPCfam | MC237351
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 225 ± 29 aa |
| Residues in low-complexity regions (%) | 8.68 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 39.57 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF11976 |
| Sequences matching dominant architecture (%) | 92.28 |
| Average overlap percent | 31.47 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A066VNA2 | 6-153 | 148 | ILRCQSRRLFDGGTPASLIAGSKLDIQAMTKTTNEYFEERHQIPPSAPGSDAADDHDGASGSQDESSAVAEKITLRLRTGPKDAR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GQ36-F1 | 278-541 | 98.61 | 77.09 | View in AlphaFoldDB ↗ |