DPCfam | MC23735
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 333 ± 26 aa |
| Residues in low-complexity regions (%) | 9.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I5EJZ0 | 11-335 | 325 | VHYSQLYVTSSPDLISDLQGCFLGQENGLCGAASPGALYLITGLHTGDVGVVVESHSEPPPVDKDWEEIVEVSFTPETDDVTLMQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F6R9-F1 | 9-355 | 100.00 | 94.40 | View in AlphaFoldDB ↗ |