DPCfam | MC237173
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Residues in low-complexity regions (%) | 7.51 |
| Residues in coiled-coil regions (%) | 2.83 |
| Predicted disordered residues (%) | 5.66 |
| Average transmembrane regions | 2.2 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A022Q2F6 | 9-110 | 102 | STALHDKLDEPTPWIGLYIATTSLVCTLAMAADASIGFRSKELWFPCKYFTLNAFSLTLLAVTMKLPLDLTSFTIQDDDKLARIS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0FL47-F1 | 14-111 | 98.99 | 89.58 | View in AlphaFoldDB ↗ |