DPCfam | MC237069
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 62 ± 8 aa |
| Residues in low-complexity regions (%) | 1.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.3 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF15966 |
| Sequences matching dominant architecture (%) | 96.08 |
| Average overlap percent | 52.39 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W5NH01 | 623-692 | 70 | DHLSNLPFEVLQHIAGFLDGFSLCQLSRVSRMMRDVCASLLQVRGMVILLWEKRQYPNGPSSWQIKDKVW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8TB52-F1 | 610-676 | 97.10 | 91.25 | View in AlphaFoldDB ↗ |