DPCfam | MC237055
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 81 ± 19 aa |
| Residues in low-complexity regions (%) | 0.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 59.53 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1Q2H8 | 18-88 | 70 | TSSYRQEFQAWTGVKPARSTKAKPTTVITAHSSGWAGGPGAGFQVPEVRKTFTPNASAIFQAPAPRVLNV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B8JLF5-F1 | 157-254 | 98.78 | 56.23 | View in AlphaFoldDB ↗ |