DPCfam | MC237038
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 133 ± 13 aa |
| Residues in low-complexity regions (%) | 27.92 |
| Residues in coiled-coil regions (%) | 21.39 |
| Predicted disordered residues (%) | 20.5 |
| Average transmembrane regions | 1.35 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F6R100 | 19-144 | 126 | IASVIMLLTSNASFLRLALIAALWAAVIGFFLVSRYRTQAEKAHAELEQQRQLHAVQLEQARQELSVERAHIEADAERRIKEDTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ELU5-F1 | 1-133 | 95.71 | 80.82 | View in AlphaFoldDB ↗ |