DPCfam | MC237023
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 350 ± 44 aa |
| Residues in low-complexity regions (%) | 3.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.26 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF12937 |
| Sequences matching dominant architecture (%) | 14.89 |
| Average overlap percent | 11.15 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A166Q795 | 10-292 | 283 | KATMSSLALVCRFFCAESLPRVFRSMVFSGMRHGTTAPSYSTFCRQLIAGEKTAYYLGQHVKDCTLNYWMKASDASQWVYKNFLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1LZU6-F1 | 509-567 | 16.34 | 94.96 | View in AlphaFoldDB ↗ |