DPCfam | MC237008
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 71 ± 12 aa |
| Residues in low-complexity regions (%) | 3.44 |
| Residues in coiled-coil regions (%) | 2.08 |
| Predicted disordered residues (%) | 2.96 |
| Average transmembrane regions | 0.23 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0X3NQB8 | 471-554 | 84 | FYKRCIGTLAKPLFDNTVHEKPLHDDYHTALVLSNVLELLTFCIENHAYHMKNYCLHRDVVKRVLTLLSSHHKFLVLGALRLLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q922R5-F1 | 474-563 | 98.70 | 83.39 | View in AlphaFoldDB ↗ |