DPCfam | MC236912
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Residues in low-complexity regions (%) | 26.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 64.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13926 |
| Sequences matching dominant architecture (%) | 96.3 |
| Average overlap percent | 31.18 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146X3E4 | 1264-1348 | 85 | PKSKSTKVKAEPPPKKRKKWLNVPSSVPSSSDSDSSDEAASENEMPVKGGVNNRAMREMFRSYVEMLVSTALDPDMIQALEDTDD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E9PYL2-F1 | 1775-1874 | 98.00 | 54.64 | View in AlphaFoldDB ↗ |