DPCfam | MC236877
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 289 ± 40 aa |
| Residues in low-complexity regions (%) | 4.67 |
| Residues in coiled-coil regions (%) | 1.61 |
| Predicted disordered residues (%) | 35.55 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M0YUZ3 | 247-476 | 230 | ASKPSHPSGLPVIKFDDEVGSRSKKRKRSTADVLAFRAQAVFEGGRLQCRRTPELAWADATLTEKVDGEKATTENSTFISRAQRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7MKH2-F1 | 1488-1775 | 99.32 | 53.35 | View in AlphaFoldDB ↗ |