DPCfam | MC236849
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 178 ± 26 aa |
| Residues in low-complexity regions (%) | 12.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.0 |
| Average transmembrane regions | 1.85 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A2LC52 | 31-194 | 164 | LKGFQLDAAGLVALADLQSIARWTAITGTSSFMDMLFLAPGIHKQSSAPSLSGGELPPTGALTSGYVFRVENEATVHFLQSVGKT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GST2-F1 | 30-202 | 99.43 | 83.79 | View in AlphaFoldDB ↗ |