DPCfam | MC236653
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 135 ± 10 aa |
| Residues in low-complexity regions (%) | 2.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.55 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF13185 |
| Sequences matching dominant architecture (%) | 21.31 |
| Average overlap percent | 89.41 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F9R8Q4 | 3-148 | 146 | NRYFQTTKPLNEQLEQLMQRMHTRVPAIARVSYAKYCQESDTLVTYADSEFDLWSELHHEQRLRKLNHLKQTAHTAIPRIIDDLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q55434-F1 | 1002-1079 | 55.71 | 83.06 | View in AlphaFoldDB ↗ |