DPCfam | MC236512
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 200 ± 17 aa |
| Residues in low-complexity regions (%) | 3.34 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 21.2 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF17797 |
| Sequences matching dominant architecture (%) | 34.92 |
| Average overlap percent | 32.56 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A7RG76 | 22-254 | 233 | CDVCDVYLSSAALVDTHKNGRKHTNLVKVKADKASVQKKTIFVRGFDKSLITCADLEQLFSQFGEIRNIYIDKEKNCYALVEFET... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4KMD7-F1 | 32-223 | 99.50 | 86.46 | View in AlphaFoldDB ↗ |