DPCfam | MC236372
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 193 ± 37 aa |
| Residues in low-complexity regions (%) | 1.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02267 |
| Sequences matching dominant architecture (%) | 90.0 |
| Average overlap percent | 89.28 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A147ASF0 | 5-128 | 124 | GTTPNIKHIVIGRCFTYTTLVQPGLRYDCEEIWRQFEKAVVQQSSCNVTEEHYFEMFNMMPEIWPCDRFLFWSKTRVLVHSYAAV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q64244-F1 | 60-281 | 99.55 | 96.30 | View in AlphaFoldDB ↗ |