DPCfam | MC236282
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 256 ± 45 aa |
| Residues in low-complexity regions (%) | 3.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.79 |
| Average transmembrane regions | 1.45 |
| Dominant Pfam architecture(s) | PF10149 |
| Sequences matching dominant architecture (%) | 79.58 |
| Average overlap percent | 91.97 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E5938C | 14-165 | 152 | QMESMAYIHYSSPLAGAEFSTVGKLVLQQSGPLPHKGIHDIYDVPVIDGTSSNVEAYDLYDVFTSYVQRNVTTEYISFHPVWTSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F7B645-F1 | 20-299 | 100.00 | 92.55 | View in AlphaFoldDB ↗ |