DPCfam | MC236089
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Residues in low-complexity regions (%) | 9.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.4 |
| Average transmembrane regions | 2.05 |
| Dominant Pfam architecture(s) | PF10268 |
| Sequences matching dominant architecture (%) | 93.85 |
| Average overlap percent | 36.39 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P4W7N2 | 169-276 | 108 | YFRGEDSGGEKAMVVLSFFTYLLIALGMLILDESKLEMGLDLAYSSFNASAAAFLRAQGLPSDGPASKVTFKLSLAVLCAIIGAF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8C2L6-F1 | 150-267 | 98.33 | 88.98 | View in AlphaFoldDB ↗ |