DPCfam | MC236046
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 547 ± 102 aa |
| Residues in low-complexity regions (%) | 4.97 |
| Residues in coiled-coil regions (%) | 4.2 |
| Predicted disordered residues (%) | 16.9 |
| Average transmembrane regions | 0.15 |
| Dominant Pfam architecture(s) | PF16528 |
| Sequences matching dominant architecture (%) | 51.72 |
| Average overlap percent | 35.94 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A178W9U7 | 329-903 | 575 | KCQRMNEKETRHLSSYLVELKKASAEEMRKSVYANYAAFIRTSKEISALEGQLLSMRNLLSAQAALVHGLADGVHISSLCADDAD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1KG51-F1 | 47-682 | 99.67 | 82.78 | View in AlphaFoldDB ↗ |