DPCfam | MC236042
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 671 |
|---|---|
| Mean domain length (aa) | 170 ± 16 aa |
| Residues in low-complexity regions (%) | 3.24 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 21.77 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF14014 |
| Sequences matching dominant architecture (%) | 98.5 |
| Average overlap percent | 84.33 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A136LVS3 | 14-187 | 174 | LFTLLLSVCIFIAGGMLLGGSEAPPQPEQVRVVTSEIILEKITTEAFLVTKTVFLDQEKTIRIDQGSDWSNFWWGQTIEAEAIIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0P900-F1 | 22-202 | 96.36 | 79.59 | View in AlphaFoldDB ↗ |