DPCfam | MC235938
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 250 ± 47 aa |
| Residues in low-complexity regions (%) | 10.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 64.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A060VZD5 | 97-393 | 297 | LWDAAESDTESLVQERDYQLELQRRIGVESGDQKMTQPQEEDTDGSCLDEGELHVYDSLEVSALGQNKKNIQQQSRDKEVSRQMH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QES5-F1 | 37-298 | 100.00 | 54.85 | View in AlphaFoldDB ↗ |