DPCfam | MC235320
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 146 ± 9 aa |
| Residues in low-complexity regions (%) | 1.92 |
| Residues in coiled-coil regions (%) | 0.39 |
| Predicted disordered residues (%) | 20.38 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13676 |
| Sequences matching dominant architecture (%) | 73.91 |
| Average overlap percent | 5.41 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q7UT52 | 137-255 | 119 | IDFSNPDAYATRLEELTRVVFDKPKRIKPPLGKPPAYITDDTVVSLKCVRSARTFREVLTSGKGNPPLAFDQFKQAVLEDLEEFQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2W4FM13-F1 | 134-171 | 27.03 | 88.11 | View in AlphaFoldDB ↗ |