DPCfam | MC2353
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 332 ± 25 aa |
| Residues in low-complexity regions (%) | 2.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.77 |
| Average transmembrane regions | 0.76 |
| Dominant Pfam architecture(s) | PF10131 |
| Sequences matching dominant architecture (%) | 17.65 |
| Average overlap percent | 27.02 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G1EVZ6 | 520-870 | 351 | FGIGFVVNDKYHTDLQKEELYAKYSNRISQLKPQFTSPIIEPTTALPILFIGDDSGYSTFIRALALTNLNSSKLIPVKGPTSLSK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5P3FT45-F1 | 433-532 | 30.88 | 95.05 | View in AlphaFoldDB ↗ |