DPCfam | MC235014
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 114 ± 14 aa |
| Residues in low-complexity regions (%) | 2.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12697 |
| Sequences matching dominant architecture (%) | 80.56 |
| Average overlap percent | 11.0 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N1H6Z3 | 5-129 | 125 | IATSLLIGAASAAAVKRPTYSHGDCHQFAIPIKASSPGAVYKLPVVNNDLTTTAWAVAADCWSSEVREVVENITISGTYSIHAQL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CU32-F1 | 20-135 | 99.15 | 96.54 | View in AlphaFoldDB ↗ |