DPCfam | MC234942
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Residues in low-complexity regions (%) | 3.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.16 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13086 |
| Sequences matching dominant architecture (%) | 18.4 |
| Average overlap percent | 1.14 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B8TDS9 | 216-295 | 80 | LNSFLLDDLARVASSVAGGESSAALEAYLSLHDGTKRVDLSDDVSSGTQCGLLALGRYPTGCWPAPGDLGLVHSQQLAVN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2G1Q4-F1 | 216-289 | 91.86 | 93.15 | View in AlphaFoldDB ↗ |