DPCfam | MC234843
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 811 |
|---|---|
| Mean domain length (aa) | 320 ± 69 aa |
| Residues in low-complexity regions (%) | 1.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.49 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF12819 |
| Sequences matching dominant architecture (%) | 83.15 |
| Average overlap percent | 92.11 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D3BTZ6 | 22-316 | 295 | VQAQPDQQGFISLDCGLSPSESPYTDPVTGLIFSSDADFIQSGKRGEVGDDEISYTYKQFKDLRYFPDGVRNCYNLTVNKGISNL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0N7KL44-F1 | 30-384 | 100.00 | 93.36 | View in AlphaFoldDB ↗ |