DPCfam | MC234781
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 229 ± 21 aa |
| Residues in low-complexity regions (%) | 3.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.28 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF02026- PF00622 |
| Sequences matching dominant architecture (%) | 1.26 |
| Average overlap percent | 79.53 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183SPW1 | 568-838 | 271 | CPETNRCFSIFELEEQPDLLRQRIVYSLFRFHAETLALYRAICCHGNHNIAQRLTTHVDKDQLLHVVTSKHLSGALRSQFIELLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8WSR4-F1 | 1397-1477 | 35.91 | 72.22 | View in AlphaFoldDB ↗ |