DPCfam | MC234609
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 254 ± 31 aa |
| Residues in low-complexity regions (%) | 1.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.54 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00593 |
| Sequences matching dominant architecture (%) | 1.02 |
| Average overlap percent | 40.06 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A142XYV8 | 109-361 | 253 | HFGQAWERYPASKIFLPRLRHAAHHPYTEYRQDESTFSYLPGTGDELGWIDFESTPYQSRGQRSGISTGMGMHLLAGPVVVDAPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O84010-F1 | 123-313 | 74.32 | 88.82 | View in AlphaFoldDB ↗ |