DPCfam | MC234022
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 221 ± 15 aa |
| Residues in low-complexity regions (%) | 1.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.28 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00534 |
| Sequences matching dominant architecture (%) | 21.88 |
| Average overlap percent | 13.61 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000B398C0A | 1-238 | 238 | MNILWITNILFPDICKEIGRKIPVTGGWMKSLAEALTTTYPDVNLSVAALYGDKKNTLLKKKIKNITYYCLPFYEFETAYNPNME... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B5YEL3-F1 | 34-151 | 52.27 | 91.23 | View in AlphaFoldDB ↗ |