DPCfam | MC233973
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 155 ± 15 aa |
| Residues in low-complexity regions (%) | 4.31 |
| Residues in coiled-coil regions (%) | 32.43 |
| Predicted disordered residues (%) | 29.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10428 |
| Sequences matching dominant architecture (%) | 98.53 |
| Average overlap percent | 55.98 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K0KG39 | 563-740 | 178 | DQKLYESLHTVLESSSQVYAELNDAISKGAIANATKPAEDQQQSLNPTTIPKIKDLTNTCVVSMDLNRKIKSKLISNSIKNGSLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q59WC1-F1 | 569-712 | 95.39 | 77.95 | View in AlphaFoldDB ↗ |