DPCfam | MC233963
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Residues in low-complexity regions (%) | 1.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07189 |
| Sequences matching dominant architecture (%) | 99.01 |
| Average overlap percent | 95.1 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A023EDT9 | 11-86 | 76 | DRYNYSQPAWNICRVSTSATGHADTNKYEWLTISTGTRSPATVGHYDMLSYFAVXXNESKARIRFNIIGKMLQPCR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VHI4-F1 | 5-80 | 98.70 | 95.33 | View in AlphaFoldDB ↗ |