DPCfam | MC233791
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 61 ± 6 aa |
| Residues in low-complexity regions (%) | 0.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00640 |
| Sequences matching dominant architecture (%) | 25.0 |
| Average overlap percent | 8.35 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C3Y437 | 446-509 | 64 | SCHVFMVDPEISAHNIHAQRAQEFSITCTANPETGGCEEFPRSARPLLRTVGLLYQRGNDEGTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VCX1-F1 | 365-423 | 98.33 | 83.79 | View in AlphaFoldDB ↗ |