DPCfam | MC233788
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 105 ± 15 aa |
| Residues in low-complexity regions (%) | 1.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08337 |
| Sequences matching dominant architecture (%) | 97.23 |
| Average overlap percent | 25.5 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006802E64 | 1592-1709 | 118 | YTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6BEA0-F1 | 1649-1751 | 97.12 | 75.06 | View in AlphaFoldDB ↗ |