DPCfam | MC233742
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 4551 |
|---|---|
| Mean domain length (aa) | 109 ± 23 aa |
| Residues in low-complexity regions (%) | 7.59 |
| Residues in coiled-coil regions (%) | 0.9 |
| Predicted disordered residues (%) | 1.66 |
| Average transmembrane regions | 2.42 |
| Dominant Pfam architecture(s) | PF01066 |
| Sequences matching dominant architecture (%) | 98.55 |
| Average overlap percent | 61.98 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q6MLT8 | 8-140 | 133 | KNLPTRITLSRVFFVPVIVALMWPNTLGWNVAAACFFILASITDYYDGYYARKYNAVSNFGKFMDPIADKILVTSVLAMLLAQGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P44528-F1 | 4-131 | 98.96 | 92.79 | View in AlphaFoldDB ↗ |