DPCfam | MC233653
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 157 ± 23 aa |
| Residues in low-complexity regions (%) | 4.71 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 9.09 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF08767 |
| Sequences matching dominant architecture (%) | 19.77 |
| Average overlap percent | 40.55 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I1I4P2 | 871-1032 | 162 | TSVLMSFCLRLLQIYSSHNIGKVMLSLSSTLRSESQSEKYKDLRALLRLLTNICSKDLVGFLSDSNIEGSPDIAEVIYVGLDIVT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9C0E2-F1 | 873-1038 | 98.74 | 83.84 | View in AlphaFoldDB ↗ |