DPCfam | MC233271
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 254 ± 34 aa |
| Residues in low-complexity regions (%) | 8.43 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 22.23 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF14228 |
| Sequences matching dominant architecture (%) | 38.53 |
| Average overlap percent | 47.29 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E3Q232 | 1147-1401 | 255 | THHKMPSPLHSLENYQKHSMRTRPEVLIEQWKLYLVVACCTLTATDDQDSRASPSQTPQRRKGPPPLAIPYKRITSARALFKIVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077Z060-F1 | 37-287 | 97.23 | 70.11 | View in AlphaFoldDB ↗ |