DPCfam | MC23324
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 56 ± 5 aa |
| Residues in low-complexity regions (%) | 0.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01167 |
| Sequences matching dominant architecture (%) | 1.56 |
| Average overlap percent | 11.54 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006C9757B | 189-247 | 59 | DDITQQNYLAQVTSNIWGTKFKIVGLATFLPTNLGAVIYKTSLLHLQPRQMTIYLPEVR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7GEX9-F1 | 501-555 | 98.21 | 82.17 | View in AlphaFoldDB ↗ |