DPCfam | MC233160
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 218 ± 36 aa |
| Residues in low-complexity regions (%) | 1.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.93 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF12134 |
| Sequences matching dominant architecture (%) | 91.67 |
| Average overlap percent | 84.87 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G4KJJ0 | 1321-1515 | 195 | NGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQLIVTRKGLLDPLEVHLLDFPNISIRASE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G3V6H2-F1 | 1767-2014 | 100.00 | 85.84 | View in AlphaFoldDB ↗ |