DPCfam | MC233108
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 120 ± 19 aa |
| Residues in low-complexity regions (%) | 2.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15797 |
| Sequences matching dominant architecture (%) | 96.15 |
| Average overlap percent | 87.42 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000B36BCD1 | 7-133 | 127 | AEEYFRSMNPLASKIHEDIEDAKNSYENIWESLTEKEKTEIINESLIKPDIALKYALLDSLDFDINDPPVRKDDLMSFFGRDHGQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4KMC9-F1 | 22-130 | 93.39 | 83.08 | View in AlphaFoldDB ↗ |