DPCfam | MC233076
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 282 ± 38 aa |
| Residues in low-complexity regions (%) | 3.0 |
| Residues in coiled-coil regions (%) | 2.82 |
| Predicted disordered residues (%) | 12.46 |
| Average transmembrane regions | 0.21 |
| Dominant Pfam architecture(s) | PF06350 |
| Sequences matching dominant architecture (%) | 73.64 |
| Average overlap percent | 90.26 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182SPT1 | 46-273 | 228 | GDDTETGLRLHGAFVGLIDHIEMAKPLVRTVQSFMHEYDFDPSVPGNGFRSFLYVVECCVKTALKLARYVMENRSTILFRKALYV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7JR83-F1 | 75-375 | 98.94 | 85.95 | View in AlphaFoldDB ↗ |