DPCfam | MC232711
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Residues in low-complexity regions (%) | 15.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.06 |
| Average transmembrane regions | 0.94 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W0X7X3 | 168-258 | 91 | INMGASRGSMPDIFAAVTEESPLSREEVSRLSQERREAVRRRKEEEERMRKNPLLLIFHPALREFFSRHRLTLAVAVINITLIYL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7JV09-F1 | 967-1054 | 98.88 | 73.69 | View in AlphaFoldDB ↗ |