DPCfam | MC232471
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 252 ± 26 aa |
| Residues in low-complexity regions (%) | 6.46 |
| Residues in coiled-coil regions (%) | 2.37 |
| Predicted disordered residues (%) | 2.17 |
| Average transmembrane regions | 6.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067TIH8 | 18-270 | 253 | GTVLLTAAFCTACCSSKVPRASIWFTFVASLILTTIFNLLILGQQAGKPPNYTRCAVQAISIYSMPVLIAHTAAALLLQVYLSIV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5A9Z4-F1 | 18-295 | 93.75 | 88.45 | View in AlphaFoldDB ↗ |