DPCfam | MC23241
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 361 |
|---|---|
| Mean domain length (aa) | 525 ± 58 aa |
| Residues in low-complexity regions (%) | 2.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13205 |
| Sequences matching dominant architecture (%) | 80.39 |
| Average overlap percent | 18.73 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A073I168 | 1-377 | 377 | MEDKYVRNSLRFFIGVLLLVVLYSCANIASPNGGPYDEAPPKFVSSTPLPGQINYKGKKVEIIFDELIQIDKPTENVIITPPQME... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6FHT0-F1 | 100-194 | 17.59 | 86.53 | View in AlphaFoldDB ↗ |