DPCfam | MC232282
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 175 ± 12 aa |
| Residues in low-complexity regions (%) | 10.18 |
| Residues in coiled-coil regions (%) | 0.87 |
| Predicted disordered residues (%) | 3.61 |
| Average transmembrane regions | 4.35 |
| Dominant Pfam architecture(s) | PF05230- PF00990 |
| Sequences matching dominant architecture (%) | 64.6 |
| Average overlap percent | 53.8 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D8KBK9 | 5-180 | 176 | GLSAGSVLYELHASLWAWIFLLFTAFVWPHIAYLHSRSSQDTVAAEKQNLFLDSIFIGLWLPLMHFSPLPSVVIPMITTLDKSYT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0AAP1-F1 | 40-213 | 99.43 | 93.32 | View in AlphaFoldDB ↗ |