DPCfam | MC232184
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Residues in low-complexity regions (%) | 1.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09818 |
| Sequences matching dominant architecture (%) | 95.59 |
| Average overlap percent | 29.74 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q3ACF4 | 180-287 | 108 | LRSFLQKNNYIAFIADGSILPRASGQSEKPLKNAVPFKSPESLRITVDLPNSGPISGLAIPKGVTVIIGGGFHGKSTLLKALEKG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q57ZF2-F1 | 246-359 | 98.28 | 97.78 | View in AlphaFoldDB ↗ |